General Information

  • ID:  hor004670
  • Uniprot ID:  Q8S8M2
  • Protein name:  CLAVATA3/ESR (CLE)-related protein 16
  • Gene name:  CLE16
  • Organism:  Arabidopsis thaliana (Mouse-ear cress)
  • Family:  CLV3/ESR signal peptide family
  • Source:  Plant
  • Expression:  [CLE16p]: Expressed in roots, stems, apex, seedlings, leaves, flowers and siliques.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Arabidopsis (genus), Camelineae (tribe), Brassicaceae (family), Brassicales (order), malvids, rosids, Pentapetalae, Gunneridae, eudicotyledons, Mesangiospermae, Magnoliopsida (class), Spermatophyta, Euphyllophyta, Tracheophyta, Embryophyta, Streptophytina (subphylum), Streptophyta (phylum), Viridiplantae (kingdom), Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0010078 maintenance of root meristem identity; GO:0010088 phloem development; GO:0030154 cell differentiation; GO:0045168 cell-cell signaling involved in cell fate commitment; GO:0045595 regulation of cell differentiation; GO:0048731 system development
  • GO CC:  GO:0005576 extracellular region; GO:0048046 apoplast

Sequence Information

  • Sequence:  AAVFFCGIFVFAQFGISSSALFAPDHYPSLPRKAGHFHEMASFQAPKATVSFTGQRREEENRDEVYKDDKRLVHTGPNPLHN
  • Length:  82
  • Propeptide:  MEACSRKRRRRRAYTTSTTGYAAVFFCGIFVFAQFGISSSALFAPDHYPSLPRKAGHFHEMASFQAPKATVSFTGQRREEENRDEVYKDDKRLVHTGPNPLHN
  • Signal peptide:  MEACSRKRRRRRAYTTSTTGY
  • Modification:  T77 Hydroxyproline
  • Glycosylation:  T77 O-linked (Ara...) hydroxyproline
  • Mutagenesis:  NA

Activity

  • Function:  Extracellular signal peptide that regulates cell fate. Represses root apical meristem maintenance.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q8S8M2-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor004670_AF2.pdbhor004670_ESM.pdb

Physical Information

Mass: 1066828 Formula: C417H619N117O118S2
Absent amino acids: W Common amino acids: AF
pI: 7.73 Basic residues: 14
Polar residues: 20 Hydrophobic residues: 29
Hydrophobicity: -44.76 Boman Index: -15280
Half-Life: 4.4 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 57.2
Instability Index: 4274.88 Extinction Coefficient cystines: 2980
Absorbance 280nm: 36.79

Literature

  • PubMed ID:  30114285
  • Title:  The Signaling Peptide-Encoding Genes CLE16, CLE17 and CLE27 Are Dispensable for Arabidopsis Shoot Apical Meristem Activity